| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Elongation of very long chain fatty acids protein 6 |
|---|
| Ligand | BDBM50299941 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_592844 (CHEMBL1045787) |
|---|
| IC50 | 1364±n/a nM |
|---|
| Citation |  Mizutani, T; Ishikawa, S; Nagase, T; Takahashi, H; Fujimura, T; Sasaki, T; Nagumo, A; Shimamura, K; Miyamoto, Y; Kitazawa, H; Kanesaka, M; Yoshimoto, R; Aragane, K; Tokita, S; Sato, N Discovery of novel benzoxazinones as potent and orally active long chain fatty acid elongase 6 inhibitors. J Med Chem52:7289-300 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Elongation of very long chain fatty acids protein 6 |
|---|
| Name: | Elongation of very long chain fatty acids protein 6 |
|---|
| Synonyms: | ELOV6_HUMAN | ELOVL6 | FACE | LCE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31392.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_572238 |
|---|
| Residue: | 265 |
|---|
| Sequence: | MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL
SYLVLFCHFFFEAYIGKMRKTTKAE
|
|
|
|---|
| BDBM50299941 |
|---|
| n/a |
|---|
| Name | BDBM50299941 |
|---|
| Synonyms: | (6-chloro-4-methyl-2-oxo-1,4-dihydro-2H-3,1-benzoxazin-4-yl)methyl(4-fluorophenyl)carbamate | CHEMBL570350 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14ClFN2O4 |
|---|
| Mol. Mass. | 364.755 |
|---|
| SMILES | CC1(COC(=O)Nc2ccc(F)cc2)OC(=O)Nc2ccc(Cl)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
