| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cell division control protein 42 homolog |
|---|
| Ligand | BDBM50300546 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588744 (CHEMBL1053691) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Beausoleil, E; Chauvignac, C; Taverne, T; Lacombe, S; Pognante, L; Leblond, B; Pallares, D; Oliveira, CD; Bachelot, F; Carton, R; Peillon, H; Coutadeur, S; Picard, V; Lambeng, N; Désiré, L; Schweighoffer, F Structure-activity relationship of isoform selective inhibitors of Rac1/1b GTPase nucleotide binding. Bioorg Med Chem Lett19:5594-8 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cell division control protein 42 homolog |
|---|
| Name: | Cell division control protein 42 homolog |
|---|
| Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21258.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_652970 |
|---|
| Residue: | 191 |
|---|
| Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
|---|
| BDBM50300546 |
|---|
| n/a |
|---|
| Name | BDBM50300546 |
|---|
| Synonyms: | 6,7-Dimethoxy-1-methyl-3-naphthalen-2-yl-isoquinolinium chloride | CHEMBL576002 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19NO2 |
|---|
| Mol. Mass. | 329.3918 |
|---|
| SMILES | COc1cc2cc(nc(C)c2cc1OC)-c1ccc2ccccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
