Reaction Details |
| Report a problem with these data |
Target | Cell division control protein 42 homolog |
---|
Ligand | BDBM25525 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_588744 (CHEMBL1053691) |
---|
IC50 | 32000±n/a nM |
---|
Citation | Beausoleil, E; Chauvignac, C; Taverne, T; Lacombe, S; Pognante, L; Leblond, B; Pallares, D; Oliveira, CD; Bachelot, F; Carton, R; Peillon, H; Coutadeur, S; Picard, V; Lambeng, N; Désiré, L; Schweighoffer, F Structure-activity relationship of isoform selective inhibitors of Rac1/1b GTPase nucleotide binding. Bioorg Med Chem Lett19:5594-8 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cell division control protein 42 homolog |
---|
Name: | Cell division control protein 42 homolog |
Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
Type: | PROTEIN |
Mol. Mass.: | 21258.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_652970 |
Residue: | 191 |
Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
BDBM25525 |
---|
n/a |
---|
Name | BDBM25525 |
Synonyms: | 24-methyl-5,7,18,20-tetraoxa-24-azahexacyclo[11.11.0.0^{2,10}.0^{4,8}.0^{14,22}.0^{17,21}]tetracosa-1(13),2,4(8),9,11,14(22),15,17(21),23-nonaen-24-ium | CHEMBL490129 | Pseudochelerythrine | Veadent | cid_5154 | sanguinarine | sangvinarin |
Type | Small organic molecule |
Emp. Form. | C20H14NO4 |
Mol. Mass. | 332.3289 |
SMILES | C[n+]1cc2c3OCOc3ccc2c2ccc3cc4OCOc4cc3c12 |
Structure |
|