| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM50308134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_610068 (CHEMBL1072477) |
|---|
| Ki | >628±n/a nM |
|---|
| Citation |  Blouin, M; Han, Y; Burch, J; Farand, J; Mellon, C; Gaudreault, M; Wrona, M; Lévesque, JF; Denis, D; Mathieu, MC; Stocco, R; Vigneault, E; Therien, A; Clark, P; Rowland, S; Xu, D; O'Neill, G; Ducharme, Y; Friesen, R The discovery of 4-{1-[({2,5-dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}carbonyl)amino]cyclopropyl}benzoic acid (MK-2894), a potent and selective prostaglandin E2 subtype 4 receptor antagonist. J Med Chem53:2227-38 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM50308134 |
|---|
| n/a |
|---|
| Name | BDBM50308134 |
|---|
| Synonyms: | 4-[({[2,5-Dichloro-4-(3-chlorobenzyl)-3-thienyl]carbonyl}amino)methyl]benzoic acid | CHEMBL601299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14Cl3NO3S |
|---|
| Mol. Mass. | 454.754 |
|---|
| SMILES | OC(=O)c1ccc(CNC(=O)c2c(Cl)sc(Cl)c2Cc2cccc(Cl)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
