Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP1 subtype |
---|
Ligand | BDBM50308128 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_610065 (CHEMBL1072474) |
---|
Ki | >2117±n/a nM |
---|
Citation | Blouin, M; Han, Y; Burch, J; Farand, J; Mellon, C; Gaudreault, M; Wrona, M; Lévesque, JF; Denis, D; Mathieu, MC; Stocco, R; Vigneault, E; Therien, A; Clark, P; Rowland, S; Xu, D; O'Neill, G; Ducharme, Y; Friesen, R The discovery of 4-{1-[({2,5-dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}carbonyl)amino]cyclopropyl}benzoic acid (MK-2894), a potent and selective prostaglandin E2 subtype 4 receptor antagonist. J Med Chem53:2227-38 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP1 subtype |
---|
Name: | Prostaglandin E2 receptor EP1 subtype |
Synonyms: | PE2R1_HUMAN | PGE receptor, EP1 subtype | PTGER1 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP1 subtype | Prostaglandin E2 receptor EP1 subtype (EP1) | Prostanoid EP1 receptor |
Type: | Enzyme |
Mol. Mass.: | 41834.57 |
Organism: | Homo sapiens (Human) |
Description: | P34995 |
Residue: | 402 |
Sequence: | MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
|
|
|
BDBM50308128 |
---|
n/a |
---|
Name | BDBM50308128 |
Synonyms: | 4-[(1S)-1-({[4-(4-Chlorobenzyl)-2,5-dimethyl-3-thienyl]carbonyl}-amino)ethyl]benzoicAcid | CHEMBL599262 |
Type | Small organic molecule |
Emp. Form. | C23H22ClNO3S |
Mol. Mass. | 427.944 |
SMILES | C[C@H](NC(=O)c1c(C)sc(C)c1Cc1ccc(Cl)cc1)c1ccc(cc1)C(O)=O |r| |
Structure |
|