| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50308134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_610066 (CHEMBL1072475) |
|---|
| Ki | >628±n/a nM |
|---|
| Citation |  Blouin, M; Han, Y; Burch, J; Farand, J; Mellon, C; Gaudreault, M; Wrona, M; Lévesque, JF; Denis, D; Mathieu, MC; Stocco, R; Vigneault, E; Therien, A; Clark, P; Rowland, S; Xu, D; O'Neill, G; Ducharme, Y; Friesen, R The discovery of 4-{1-[({2,5-dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}carbonyl)amino]cyclopropyl}benzoic acid (MK-2894), a potent and selective prostaglandin E2 subtype 4 receptor antagonist. J Med Chem53:2227-38 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50308134 |
|---|
| n/a |
|---|
| Name | BDBM50308134 |
|---|
| Synonyms: | 4-[({[2,5-Dichloro-4-(3-chlorobenzyl)-3-thienyl]carbonyl}amino)methyl]benzoic acid | CHEMBL601299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14Cl3NO3S |
|---|
| Mol. Mass. | 454.754 |
|---|
| SMILES | OC(=O)c1ccc(CNC(=O)c2c(Cl)sc(Cl)c2Cc2cccc(Cl)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
