Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50308134 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_610070 (CHEMBL1072479) |
---|
Ki | >628±n/a nM |
---|
Citation | Blouin, M; Han, Y; Burch, J; Farand, J; Mellon, C; Gaudreault, M; Wrona, M; Lévesque, JF; Denis, D; Mathieu, MC; Stocco, R; Vigneault, E; Therien, A; Clark, P; Rowland, S; Xu, D; O'Neill, G; Ducharme, Y; Friesen, R The discovery of 4-{1-[({2,5-dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}carbonyl)amino]cyclopropyl}benzoic acid (MK-2894), a potent and selective prostaglandin E2 subtype 4 receptor antagonist. J Med Chem53:2227-38 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50308134 |
---|
n/a |
---|
Name | BDBM50308134 |
Synonyms: | 4-[({[2,5-Dichloro-4-(3-chlorobenzyl)-3-thienyl]carbonyl}amino)methyl]benzoic acid | CHEMBL601299 |
Type | Small organic molecule |
Emp. Form. | C20H14Cl3NO3S |
Mol. Mass. | 454.754 |
SMILES | OC(=O)c1ccc(CNC(=O)c2c(Cl)sc(Cl)c2Cc2cccc(Cl)c2)cc1 |
Structure |
|