| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50311076 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_619548 (CHEMBL1111405) |
|---|
| Ki | 3166±n/a nM |
|---|
| Citation |  Donohue, SR; Varnäs, K; Jia, Z; Gulyás, B; Pike, VW; Halldin, C Synthesis and in vitro autoradiographic evaluation of a novel high-affinity radioiodinated ligand for imaging brain cannabinoid subtype-1 receptors. Bioorg Med Chem Lett19:6209-12 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50311076 |
|---|
| n/a |
|---|
| Name | BDBM50311076 |
|---|
| Synonyms: | CHEMBL1079079 | [125I]1-(2-iodophenyl)-4-cyano-5-(4-methoxyphenyl)-N-(piperidin-1-yl)-1H-pyrazole-3-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22IN5O2 |
|---|
| Mol. Mass. | 527.3576 |
|---|
| SMILES | COc1ccc(cc1)-c1c(C#N)c(nn1-c1ccccc1I)C(=O)NN1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
