Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lyn
LigandBDBM50311921
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619937
IC50 5±n/a nM
Citation Zhang GRen PGray NSSim TWang XLiu YChe JDong WTian SSSandberg MLSpalding TARomeo RIskandar MWang ZSeidel HMKaranewsky DSHe Y Discovery of pyrimidine benzimidazoles as Src-family selective Lck inhibitors. Part II. Bioorg Med Chem Lett 19:6691-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lyn
Name:Tyrosine-protein kinase Lyn
Synonyms:JTK8 | LYN | Lck/Yes-related novel protein tyrosine kinase | Tyrosine-protein kinase Lyn (LYN) | V-yes-1 Yamaguchi sarcoma viral related oncogene homolog | p53Lyn | p56Lyn
Type:Protein
Mol. Mass.:58575.92
Organism:Homo sapiens (Human)
Description:P07948
Residue:512
Sequence:
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311921
n/a
NameBDBM50311921
Synonyms:CHEMBL1086731 | N-(3-(1-(6-aminopyrimidin-4-yl)-1H-benzo[d]imidazol-2-ylamino)-4-methylphenyl)-5-tert-butylthiophene-2-carboxamide
TypeSmall organic molecule
Emp. Form.C27H27N7OS
Mol. Mass.497.615
SMILESCc1ccc(NC(=O)c2ccc(s2)C(C)(C)C)cc1Nc1nc2ccccc2n1-c1cc(N)ncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: