| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50313223 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_616836 (CHEMBL1100220) |
|---|
| IC50 | <750±n/a nM |
|---|
| Citation |  Wang, J; Limburg, D; Carter, J; Mbalaviele, G; Gierse, J; Vazquez, M Selective inducible microsomal prostaglandin E(2) synthase-1 (mPGES-1) inhibitors derived from an oxicam template. Bioorg Med Chem Lett20:1604-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50313223 |
|---|
| n/a |
|---|
| Name | BDBM50313223 |
|---|
| Synonyms: | 4-Hydroxy-1,1-dioxo-1,2-dihydro-1lambda*6*-benzo[e][1,2]thiazine-3-carboxylic acid(3',4'-dimethyl-biphenyl-4-yl)-amide | CHEMBL1086884 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H20N2O4S |
|---|
| Mol. Mass. | 420.481 |
|---|
| SMILES | Cc1ccc(cc1C)-c1ccc(NC(=O)C2=C(O)c3ccccc3S(=O)(=O)N2)cc1 |c:16| |
|---|
| Structure | 
|
|---|
Search and Browse
