Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50315301
Substrate/Competitorn/a
Meas. Tech.ChEMBL_626229
IC50 3200±n/a nM
Citation Skerlj RTBridger GJKaller AMcEachern EJCrawford JBZhou YAtsma BLangille JNan SVeale DWilson THarwig CHatse SPrincen KDe Clercq ESchols D Discovery of novel small molecule orally bioavailable C-X-C chemokine receptor 4 antagonists that are potent inhibitors of T-tropic (X4) HIV-1 replication. J Med Chem 53:3376-88 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315301
n/a
NameBDBM50315301
Synonyms:CHEMBL1092629 | N-((1H-Benzo[d]imidazol-2-yl)methyl)-4-methyl-N-(5,6,7,8-tetrahydroquinolin-8-yl)butanamide
TypeSmall organic molecule
Emp. Form.C21H25N5O
Mol. Mass.363.4561
SMILESNCCCC(=O)N(Cc1nc2ccccc2[nH]1)C1CCCc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: