Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lyn
LigandBDBM50315888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_625020
IC50 26±n/a nM
Citation Fidanze SDErickson SAWang GTMantei RClark RFSorensen BKBamaung NYKovar PJohnson EFSwinger KKStewart KDZhang QTucker LAPappano WNWilsbacher JLWang JSheppard GSBell RLDavidsen SKHubbard RD Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases. Bioorg Med Chem Lett 20:2452-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lyn
Name:Tyrosine-protein kinase Lyn
Synonyms:JTK8 | LYN | Lck/Yes-related novel protein tyrosine kinase | Tyrosine-protein kinase Lyn (LYN) | V-yes-1 Yamaguchi sarcoma viral related oncogene homolog | p53Lyn | p56Lyn
Type:Protein
Mol. Mass.:58575.92
Organism:Homo sapiens (Human)
Description:P07948
Residue:512
Sequence:
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315888
n/a
NameBDBM50315888
Synonyms:CHEMBL1090360 | N-(3-(5-(2-(3-morpholinophenylamino)pyrimidin-4-yl)imidazo[2,1-b]thiazol-6-yl)phenyl)-2-phenylacetamide
TypeSmall organic molecule
Emp. Form.C33H29N7O2S
Mol. Mass.587.694
SMILESO=C(Cc1ccccc1)Nc1cccc(c1)-c1nc2sccn2c1-c1ccnc(Nc2cccc(c2)N2CCOCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: