Reaction Details |
| Report a problem with these data |
Target | 6,7-dimethyl-8-ribityllumazine synthase |
---|
Ligand | BDBM50316578 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_631472 (CHEMBL1114706) |
---|
Ki | 99000±n/a nM |
---|
Citation | Talukdar, A; Morgunova, E; Duan, J; Meining, W; Foloppe, N; Nilsson, L; Bacher, A; Illarionov, B; Fischer, M; Ladenstein, R; Cushman, M Virtual screening, selection and development of a benzindolone structural scaffold for inhibition of lumazine synthase. Bioorg Med Chem18:3518-34 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
6,7-dimethyl-8-ribityllumazine synthase |
---|
Name: | 6,7-dimethyl-8-ribityllumazine synthase |
Synonyms: | RISB_MYCTU | ribH |
Type: | PROTEIN |
Mol. Mass.: | 16367.39 |
Organism: | Mycobacterium tuberculosis |
Description: | ChEMBL_631469 |
Residue: | 160 |
Sequence: | MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAI
EIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTN
TEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
|
|
|
BDBM50316578 |
---|
n/a |
---|
Name | BDBM50316578 |
Synonyms: | 3-(2-Oxo-1,2-dihydrobenzo[cd]indole-6-sulfonamido)propyl dihydrogen phosphate | CHEMBL1097476 |
Type | Small organic molecule |
Emp. Form. | C14H15N2O7PS |
Mol. Mass. | 386.317 |
SMILES | OP(O)(=O)OCCCNS(=O)(=O)c1ccc2NC(=O)c3cccc1c23 |
Structure |
|