Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor |
---|
Ligand | BDBM50319839 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_634906 (CHEMBL1120633) |
---|
Ki | 1389±n/a nM |
---|
Citation | Colucci, J; Boyd, M; Berthelette, C; Chiasson, JF; Wang, Z; Ducharme, Y; Friesen, R; Wrona, M; Levesque, JF; Denis, D; Mathieu, MC; Stocco, R; Therien, AG; Clarke, P; Rowland, S; Xu, D; Han, Y Discovery of 4-[1-[([1-[4-(trifluoromethyl)benzyl]-1H-indol-7-yl]carbonyl)amino]cyclopropyl]benzoic acid (MF-766), a highly potent and selective EP4 antagonist for treating inflammatory pain. Bioorg Med Chem Lett20:3760-3 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor |
---|
Name: | Prostaglandin D2 receptor |
Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
Type: | Enzyme |
Mol. Mass.: | 40288.87 |
Organism: | Homo sapiens (Human) |
Description: | Q13258 |
Residue: | 359 |
Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
BDBM50319839 |
---|
n/a |
---|
Name | BDBM50319839 |
Synonyms: | (S)-4-(1-(1-(4-(trifluoromethyl)benzyl)-1H-indole-7-carboxamido)ethyl)benzoic acid | CHEMBL1084553 |
Type | Small organic molecule |
Emp. Form. | C26H21F3N2O3 |
Mol. Mass. | 466.4517 |
SMILES | C[C@H](NC(=O)c1cccc2ccn(Cc3ccc(cc3)C(F)(F)F)c12)c1ccc(cc1)C(O)=O |r| |
Structure |
|