Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50319837 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_634909 (CHEMBL1120636) |
---|
Ki | 7400±n/a nM |
---|
Citation | Colucci, J; Boyd, M; Berthelette, C; Chiasson, JF; Wang, Z; Ducharme, Y; Friesen, R; Wrona, M; Levesque, JF; Denis, D; Mathieu, MC; Stocco, R; Therien, AG; Clarke, P; Rowland, S; Xu, D; Han, Y Discovery of 4-[1-[([1-[4-(trifluoromethyl)benzyl]-1H-indol-7-yl]carbonyl)amino]cyclopropyl]benzoic acid (MF-766), a highly potent and selective EP4 antagonist for treating inflammatory pain. Bioorg Med Chem Lett20:3760-3 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
Type: | Enzyme |
Mol. Mass.: | 43335.03 |
Organism: | Homo sapiens (Human) |
Description: | P43115 |
Residue: | 390 |
Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
BDBM50319837 |
---|
n/a |
---|
Name | BDBM50319837 |
Synonyms: | 4-(1-(1-(4-(trifluoromethyl)benzyl)-1H-indole-7-carboxamido)cyclopropyl)benzoic acid | CHEMBL1084009 |
Type | Small organic molecule |
Emp. Form. | C27H21F3N2O3 |
Mol. Mass. | 478.4624 |
SMILES | OC(=O)c1ccc(cc1)C1(CC1)NC(=O)c1cccc2ccn(Cc3ccc(cc3)C(F)(F)F)c12 |
Structure |
|