| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50319837 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_634912 (CHEMBL1117652) |
|---|
| Ki | 6700±n/a nM |
|---|
| Citation |  Colucci, J; Boyd, M; Berthelette, C; Chiasson, JF; Wang, Z; Ducharme, Y; Friesen, R; Wrona, M; Levesque, JF; Denis, D; Mathieu, MC; Stocco, R; Therien, AG; Clarke, P; Rowland, S; Xu, D; Han, Y Discovery of 4-[1-[([1-[4-(trifluoromethyl)benzyl]-1H-indol-7-yl]carbonyl)amino]cyclopropyl]benzoic acid (MF-766), a highly potent and selective EP4 antagonist for treating inflammatory pain. Bioorg Med Chem Lett20:3760-3 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50319837 |
|---|
| n/a |
|---|
| Name | BDBM50319837 |
|---|
| Synonyms: | 4-(1-(1-(4-(trifluoromethyl)benzyl)-1H-indole-7-carboxamido)cyclopropyl)benzoic acid | CHEMBL1084009 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H21F3N2O3 |
|---|
| Mol. Mass. | 478.4624 |
|---|
| SMILES | OC(=O)c1ccc(cc1)C1(CC1)NC(=O)c1cccc2ccn(Cc3ccc(cc3)C(F)(F)F)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
