Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM50323393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_644014
IC50 150±n/a nM
Citation Imbriglio JEChang SLiang RRaghavan SSchmidt DSmenton ATria SSchrader TOJung JKEsser CHolt TGWolff MSTaggart AKCheng KCarballo-Jane EWaters MGTata JRColletti SL GPR109a agonists. Part 2: pyrazole-acids as agonists of the human orphan G-protein coupled receptor GPR109a. Bioorg Med Chem Lett 20:4472-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41418.01
Organism:Mus musculus
Description:ChEMBL_820676
Residue:360
Sequence:
MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSIC
YNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIIC
FLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323393
n/a
NameBDBM50323393
Synonyms:5-phenyl-1,4,5,6-tetrahydrocyclopenta[c]pyrazole-3-carboxylic acid | CHEMBL1208922
TypeSmall organic molecule
Emp. Form.C13H12N2O2
Mol. Mass.228.2466
SMILESOC(=O)c1n[nH]c2CC(Cc12)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: