Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 5 |
---|
Ligand | BDBM50323441 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_644105 (CHEMBL1212004) |
---|
IC50 | 123±n/a nM |
---|
Citation | Guo, L; Ye, Z; Liu, J; He, S; Bakshi, RK; Sebhat, IK; Dobbelaar, PH; Hong, Q; Jian, T; Dellureficio, JP; Tsou, NN; Ball, RG; Weinberg, DH; MacNeil, T; Tang, R; Tamvakopoulos, C; Peng, Q; Chen, HY; Chen, AS; Martin, WJ; MacIntyre, DE; Strack, AM; Fong, TM; Wyvratt, MJ; Nargund, RP Discovery of potent, selective, and orally bioavailable 3H-spiro[isobenzofuran-1,4'-piperidine] based melanocortin subtype-4 receptor agonists. Bioorg Med Chem Lett20:4895-900 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 5 |
---|
Name: | Melanocortin receptor 5 |
Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
Type: | Enzyme |
Mol. Mass.: | 36612.92 |
Organism: | Homo sapiens (Human) |
Description: | P33032 |
Residue: | 325 |
Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
BDBM50323441 |
---|
n/a |
---|
Name | BDBM50323441 |
Synonyms: | 2-((S)-6-chloro-1'-((3S,4R)-4-(2,4-difluorophenyl)-1-(tetrahydro-2H-pyran-4-yl)pyrrolidine-3-carbonyl)-5-methyl-3H-spiro[isobenzofuran-1,4'-piperidine]-3-yl)-2-methylpropanenitrile | CHEMBL1209788 |
Type | Small organic molecule |
Emp. Form. | C33H38ClF2N3O3 |
Mol. Mass. | 598.123 |
SMILES | Cc1cc2[C@H](OC3(CCN(CC3)C(=O)[C@@H]3CN(C[C@H]3c3ccc(F)cc3F)C3CCOCC3)c2cc1Cl)C(C)(C)C#N |r| |
Structure |
|