Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransmembrane protease serine 6
LigandBDBM50286441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_649220
Ki 2400±n/a nM
Citation Sisay MTSteinmetzer TStirnberg MMaurer EHammami MBajorath JGütschow M Identification of the first low-molecular-weight inhibitors of matriptase-2. J Med Chem 53:5523-35 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transmembrane protease serine 6
Name:Transmembrane protease serine 6
Synonyms:Matriptase-2
Type:PROTEIN
Mol. Mass.:90001.12
Organism:Homo sapiens (Human)
Description:ChEMBL_1442547
Residue:811
Sequence:
MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLL
ALLVLASAGVLLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
MLKELITSTRLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELL
STVNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDH
LASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE
VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYY
SPQTHCSWHLTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAE
RIPVVATAGITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDC
PNGLDERNCVCRATFQCKEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCED
RSCVKKPNPQCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH
ICGGALIADRWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYH
EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPISNAL
QKVDVQLIPQDLCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGL
VSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286441
n/a
NameBDBM50286441
Synonyms:(S)-2-((S)-2-Acetylamino-4-(S)-methyl-pentanoylamino)-4-methyl-pentanoic acid (1-formyl-4-guanidino-butyl)-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(R)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(S)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-[(S)-2-((S)-2-Acetylamino-4-methyl-pentanoylamino)-4-methyl-pentanoylamino]-5-guanidino-pentanoic acid | (S)-2-acetylamino-4-methyl-pentanoic acid [(S)-2-(1-formyl-4-guanidino-butylamino)-4-methyl-pentanoyl]-amide | 2-Acetylamino-4-methyl-pentanoic acid [1-(1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | Ac-LLR-CHO | Ac-Leu-Leu-Arg-H | CHEMBL129157
TypeSmall organic molecule
Emp. Form.C20H38N6O5
Mol. Mass.442.5529
SMILESCC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: