| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50302839 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_673657 (CHEMBL1274834) |
|---|
| IC50 | 230±n/a nM |
|---|
| Citation |  Truong, AP; Tóth, G; Probst, GD; Sealy, JM; Bowers, S; Wone, DW; Dressen, D; Hom, RK; Konradi, AW; Sham, HL; Wu, J; Peterson, BT; Ruslim, L; Bova, MP; Kholodenko, D; Motter, RN; Bard, F; Santiago, P; Ni, H; Chian, D; Soriano, F; Cole, T; Brigham, EF; Wong, K; Zmolek, W; Goldbach, E; Samant, B; Chen, L; Zhang, H; Nakamura, DF; Quinn, KP; Yednock, TA; Sauer, JM Design of an orally efficacious hydroxyethylamine (HEA) BACE-1 inhibitor in a preclinical animal model. Bioorg Med Chem Lett20:6231-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50302839 |
|---|
| n/a |
|---|
| Name | BDBM50302839 |
|---|
| Synonyms: | CHEMBL570556 | N-((2S,3R)-4-(4-(3-tert-butylphenyl)tetrahydro-2H-pyran-4-ylamino)-1-(3,5-difluorophenyl)-3-hydroxybutan-2-yl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H36F2N2O3 |
|---|
| Mol. Mass. | 474.5831 |
|---|
| SMILES | CC(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)CNC1(CCOCC1)c1cccc(c1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
