Reaction Details |
| Report a problem with these data |
Target | C-C motif chemokine 5 |
---|
Ligand | BDBM50329228 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_675123 (CHEMBL1272914) |
---|
IC50 | >500±n/a nM |
---|
Citation | Wanner, J; Chen, L; Lemoine, RC; Kondru, R; Jekle, A; Heilek, G; deRosier, A; Ji, C; Berry, PW; Rotstein, DM Evaluation of amide replacements in CCR5 antagonists as a means to increase intrinsic permeability. Part 2: SAR optimization and pharmacokinetic profile of a homologous azacyle series. Bioorg Med Chem Lett20:6802-7 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C motif chemokine 5 |
---|
Name: | C-C motif chemokine 5 |
Synonyms: | CCL5 | CCL5_HUMAN | D17S136E | EoCP | Eosinophil chemotactic cytokine | RANTES(3-68) | RANTES(4-68) | SCYA5 | SIS-delta | Small-inducible cytokine A5 | T cell-specific protein P228 | T-cell-specific protein RANTES | TCP228 |
Type: | PROTEIN |
Mol. Mass.: | 9996.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1363187 |
Residue: | 91 |
Sequence: | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
|
|
|
BDBM50329228 |
---|
n/a |
---|
Name | BDBM50329228 |
Synonyms: | 4-(3-((3aR,6aS)-5-(4,6-dimethylpyrimidine-5-carbonyl)hexahydropyrrolo[3,4-c]pyrrol-2(1H)-yl)-1-phenylpropyl)-N-isopropylpiperidine-1-carboxamide | CHEMBL1270400 |
Type | Small organic molecule |
Emp. Form. | C31H44N6O2 |
Mol. Mass. | 532.7201 |
SMILES | CC(C)NC(=O)N1CCC(CC1)C(CCN1C[C@H]2CN(C[C@H]2C1)C(=O)c1c(C)ncnc1C)c1ccccc1 |r| |
Structure |
|