Reaction Details |
| Report a problem with these data |
Target | Lactoylglutathione lyase |
---|
Ligand | BDBM17638 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_716548 (CHEMBL1670272) |
---|
Ki | 24000±n/a nM |
---|
Citation | Yuan, M; Luo, M; Song, Y; Xu, Q; Wang, X; Cao, Y; Bu, X; Ren, Y; Hu, X Identification of curcumin derivatives as human glyoxalase I inhibitors: A combination of biological evaluation, molecular docking, 3D-QSAR and molecular dynamics simulation studies. Bioorg Med Chem19:1189-96 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Lactoylglutathione lyase |
---|
Name: | Lactoylglutathione lyase |
Synonyms: | Aldoketomutase | GLO1 | Glx I | Glyoxalase 1 (GLO1) | Glyoxalase I | Ketone-aldehyde mutase | LGUL_HUMAN | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase |
Type: | Enzyme |
Mol. Mass.: | 20772.95 |
Organism: | Homo sapiens (Human) |
Description: | Q04760 |
Residue: | 184 |
Sequence: | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
|
|
|
BDBM17638 |
---|
n/a |
---|
Name | BDBM17638 |
Synonyms: | 2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US11478464, Compound Indomethacin | US11786535, Compound Indomethacin | US9271961, Indomethacin | indometacin |
Type | Small organic molecule |
Emp. Form. | C19H16ClNO4 |
Mol. Mass. | 357.788 |
SMILES | COc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1 |
Structure |
|