| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50336507 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_725476 (CHEMBL1677337) |
|---|
| Ki | 1±n/a nM |
|---|
| Citation |  Wang, F; Jain, P; Gulten, G; Liu, Z; Feng, Y; Ganesula, K; Motiwala, AS; Ioerger, TR; Alland, D; Vilchèze, C; Jacobs, WR; Sacchettini, JC Mycobacterium tuberculosis dihydrofolate reductase is not a target relevant to the antitubercular activity of isoniazid. Antimicrob Agents Chemother54:3776-82 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MYCTU | dfrA | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17872.62 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_102873 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MTMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLP
GRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIG
LPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
|
|
|
|---|
| BDBM50336507 |
|---|
| n/a |
|---|
| Name | BDBM50336507 |
|---|
| Synonyms: | 4-pyridinecarbohydrazide(Isoniazid) | CHEMBL64 | Dow-isoniazid | Hyzyd | INH | ISONICOTINIC ACID HYDRAZIDE(ISONIAZIDE) | Isoniazid (INH) | Isonicotinic acid hydrazide (Isoniazid) | Isonicotinic acid hydrazide(Isoniazid) | Isonicotinylhydrazine | Laniazid | Nydrazid | Rimifon | Stanozide | isoniazid | isonicotinamide | isonicotinhydrazide | isonicotinohydrazide | isonicotinyl hydrazide | pyridine-4-carbohydrazide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H7N3O |
|---|
| Mol. Mass. | 137.1393 |
|---|
| SMILES | NNC(=O)c1ccncc1 |
|---|
| Structure | 
|
|---|
Search and Browse
