| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrix protein 2 [1-96] |
|---|
| Ligand | BDBM50343548 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_747076 (CHEMBL1777442) |
|---|
| IC50 | 22900±n/a nM |
|---|
| Citation |  Duque, MD; Ma, C; Torres, E; Wang, J; Naesens, L; Juárez-Jiménez, J; Camps, P; Luque, FJ; DeGrado, WF; Lamb, RA; Pinto, LH; Vázquez, S Exploring the size limit of templates for inhibitors of the M2 ion channel of influenza A virus. J Med Chem54:2646-57 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrix protein 2 [1-96] |
|---|
| Name: | Matrix protein 2 [1-96] |
|---|
| Synonyms: | M | M2_I72A2 | Matrix protein 2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11051.96 |
|---|
| Organism: | Influenza A virus |
|---|
| Description: | ChEMBL_1453980 |
|---|
| Residue: | 96 |
|---|
| Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL
|
|
|
|---|
| BDBM50343548 |
|---|
| n/a |
|---|
| Name | BDBM50343548 |
|---|
| Synonyms: | CHEMBL468166 | Methyl-(2-oxa-tricyclo[3.3.1.1(3,7)]dec-1-yl)-amine | N-Methyl(2-oxaadamant-1-yl)amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H17NO |
|---|
| Mol. Mass. | 167.2481 |
|---|
| SMILES | CNC12CC3CC(CC(C3)O1)C2 |TLB:1:2:5:9.8.7,THB:3:4:7:11.2.10,3:2:5.4.9:7,10:2:5:9.8.7,10:8:5:11.3.2,1:2:5.4.9:7| |
|---|
| Structure | 
|
|---|
Search and Browse
