Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 14 |
---|
Ligand | BDBM50343879 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_747401 (CHEMBL1776795) |
---|
IC50 | 380±n/a nM |
---|
Citation | Gauthier, JY; Belley, M; Deschênes, D; Fournier, JF; Gagné, S; Gareau, Y; Hamel, M; Hénault, M; Hyjazie, H; Kargman, S; Lavallée, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Thérien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC The identification of 4,7-disubstituted naphthoic acid derivatives as UDP-competitive antagonists of P2Y14. Bioorg Med Chem Lett21:2836-9 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 14 |
---|
Name: | P2Y purinoceptor 14 |
Synonyms: | G-protein coupled receptor 105 | Gpr105 | P2Y14 | P2Y14_MOUSE | P2ry14 | UDP-glucose receptor |
Type: | PROTEIN |
Mol. Mass.: | 38883.93 |
Organism: | Mus musculus |
Description: | ChEMBL_745158 |
Residue: | 338 |
Sequence: | MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
|
|
|
BDBM50343879 |
---|
n/a |
---|
Name | BDBM50343879 |
Synonyms: | 3-fluoro-4-(thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid | CHEMBL1774894 |
Type | Small organic molecule |
Emp. Form. | C22H12F4O3S |
Mol. Mass. | 432.387 |
SMILES | OC(=O)c1cc2cc(ccc2c(-c2ccsc2)c1F)-c1ccc(OC(F)(F)F)cc1 |
Structure |
|