| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50346329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_749285 (CHEMBL1785220) |
|---|
| Ki | 0.416±n/a nM |
|---|
| Citation |  Ballet, S; Feytens, D; Buysse, K; Chung, NN; Lemieux, C; Tumati, S; Keresztes, A; Van Duppen, J; Lai, J; Varga, E; Porreca, F; Schiller, PW; Vanden Broeck, J; Tourwé, D Design of novel neurokinin 1 receptor antagonists based on conformationally constrained aromatic amino acids and discovery of a potent chimeric opioid agonist-neurokinin 1 receptor antagonist. J Med Chem54:2467-76 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50346329 |
|---|
| n/a |
|---|
| Name | BDBM50346329 |
|---|
| Synonyms: | (R)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanamido)-N-((S)-2-(2-((3,5-bis(trifluoromethyl)benzyl)(methyl)amino)-2-oxoethyl)-3-oxo-2,3,4,5-tetrahydro-1H-benzo[c]azepin-4-yl)-5-guanidinopentanamide | CHEMBL1782141 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H46F6N8O5 |
|---|
| Mol. Mass. | 820.8236 |
|---|
| SMILES | [#6]-[#7](-[#6]-c1cc(cc(c1)C(F)(F)F)C(F)(F)F)-[#6](=O)-[#6]-[#7]-1-[#6]-c2ccccc2-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-c2c(-[#6])cc(-[#8])cc2-[#6])-[#6]-1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
