Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50354481 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_771568 (CHEMBL1837747) |
---|
Ki | 6600±n/a nM |
---|
Citation | Radi, M; Brullo, C; Crespan, E; Tintori, C; Musumeci, F; Biava, M; Schenone, S; Dreassi, E; Zamperini, C; Maga, G; Pagano, D; Angelucci, A; Bologna, M; Botta, M Identification of potent c-Src inhibitors strongly affecting the proliferation of human neuroblastoma cells. Bioorg Med Chem Lett21:5928-33 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50354481 |
---|
n/a |
---|
Name | BDBM50354481 |
Synonyms: | CHEMBL1836679 |
Type | Small organic molecule |
Emp. Form. | C21H20ClN5S |
Mol. Mass. | 409.935 |
SMILES | CSc1nc(Nc2cccc(Cl)c2)c2cnn(CC(C)c3ccccc3)c2n1 |
Structure |
|