Reaction Details |
| Report a problem with these data |
Target | Vasopressin V2 receptor |
---|
Ligand | BDBM50354894 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_772748 (CHEMBL1837360) |
---|
IC50 | 8490±n/a nM |
---|
Citation | Johnson, PS; Ryckmans, T; Bryans, J; Beal, DM; Dack, KN; Feeder, N; Harrison, A; Lewis, M; Mason, HJ; Mills, J; Newman, J; Pasquinet, C; Rawson, DJ; Roberts, LR; Russell, R; Spark, D; Stobie, A; Underwood, TJ; Ward, R; Wheeler, S Discovery of PF-184563, a potent and selective V1a antagonist for the treatment of dysmenorrhoea. The influence of compound flexibility on microsomal stability. Bioorg Med Chem Lett21:5684-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Vasopressin V2 receptor |
---|
Name: | Vasopressin V2 receptor |
Synonyms: | ADHR | AVPR V2 | AVPR2 | Antidiuretic hormone receptor | DIR | DIR3 | Renal-type arginine vasopressin receptor | V2R | V2R_HUMAN | VASOPRESSIN V2 | Vasopressin V2 receptor | Vasopressin receptor |
Type: | Receptor |
Mol. Mass.: | 40295.28 |
Organism: | Homo sapiens (Human) |
Description: | P30518 |
Residue: | 371 |
Sequence: | MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
|
|
|
BDBM50354894 |
---|
n/a |
---|
Name | BDBM50354894 |
Synonyms: | CHEMBL1837037 |
Type | Small organic molecule |
Emp. Form. | C21H23ClN6 |
Mol. Mass. | 394.901 |
SMILES | CN1Cc2nnc(C3CCN(CC3)c3ccccn3)n2-c2ccc(Cl)cc2C1 |
Structure |
|