Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase SRPK2
LigandBDBM25084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774248
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase SRPK2
Name:Serine/threonine-protein kinase SRPK2
Synonyms:SFRS protein kinase 2 | SR-protein-specific kinase 2 | SRSF protein kinase 2 | SRSF protein kinase 2 C-terminal | SRSF protein kinase 2 N-terminal | Serine/arginine-rich protein-specific kinase 2
Type:PROTEIN
Mol. Mass.:77488.98
Organism:Homo sapiens (Human)
Description:ChEMBL_774248
Residue:688
Sequence:
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDP
ADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTE
TALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQ
KAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIE
KDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQ
EESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKH
FTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIA
HIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFT
DFLIPMLEMVPEKRASAGECLRHPWLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25084
n/a
NameBDBM25084
Synonyms:3-[2,4-diamino-6-(3-hydroxyphenyl)pteridin-7-yl]phenol | JMC504279 Compound 6 | TG100-115
TypeSmall organic molecule
Emp. Form.C18H14N6O2
Mol. Mass.346.3428
SMILESNc1nc(N)c2nc(-c3cccc(O)c3)c(nc2n1)-c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: