Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 1 (EPHA1)
LigandBDBM25628
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774488
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 1 (EPHA1)
Name:Ephrin receptor
Synonyms:EPH tyrosine kinase | EPH tyrosine kinase 1 | EPHA1 | Ephrin receptor | Ephrin type-A receptor 1 | Erythropoietin-producing hepatoma receptor | Tyrosine-protein kinase receptor EPH | hEpha1
Type:Enzyme
Mol. Mass.:108128.04
Organism:Homo sapiens (Human)
Description:P21709
Residue:976
Sequence:
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25628
n/a
NameBDBM25628
Synonyms:2-{4-[(1Z)-1-(hydroxyimino)-2,3-dihydro-1H-inden-5-yl]-3-(pyridin-4-yl)-1H-pyrazol-1-yl}ethan-1-ol | AR00341677 | CHEMBL525191 | GDC-0879
TypeSmall organic molecule
Emp. Form.C19H18N4O2
Mol. Mass.334.3718
SMILESOCCn1cc(c(n1)-c1ccncc1)-c1ccc2C(CCc2c1)N=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: