Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2B
LigandBDBM5931
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774307
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAMK2B
Name:CAMK2B
Synonyms:CaM kinase II | CaM kinase II beta | CaM kinase II subunit beta | CaM-kinase II beta chain | CaMK-II subunit beta | Calcium/calmodulin-dependent protein kinase type II | Calcium/calmodulin-dependent protein kinase type II beta chain
Type:Enzyme Catalytic Domain
Mol. Mass.:72685.48
Organism:Homo sapiens (Human)
Description:gi_26051204
Residue:666
Sequence:
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5931
n/a
NameBDBM5931
Synonyms:BMS-387072 | CHEMBL296468 | N-(5-{[(5-tert-butyl-1,3-oxazol-2-yl)methyl]sulfanyl}-1,3-thiazol-2-yl)piperidine-4-carboxamide | N-[5-[[[5-(1,1-Dimethylethyl)-2-oxazolyl]methyl]thio]-2-thiazolyl]-4-piperidinecarboxamide | cid_3025986
TypeSmall organic molecule
Emp. Form.C17H24N4O2S2
Mol. Mass.380.528
SMILESCC(C)(C)c1cnc(CSc2cnc(NC(=O)C3CCNCC3)s2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: