| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 2 homolog |
|---|
| Ligand | BDBM5655 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_774240 (CHEMBL1908457) |
|---|
| Kd | 3300±n/a nM |
|---|
| Citation |  Davis, MI; Hunt, JP; Herrgard, S; Ciceri, P; Wodicka, LM; Pallares, G; Hocker, M; Treiber, DK; Zarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 2 homolog |
|---|
| Name: | Cyclin-dependent kinase 2 homolog |
|---|
| Synonyms: | CDK2H_PLAF7 | CRK2 | Cell division control protein 2 homolog | PK5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33000.81 |
|---|
| Organism: | Plasmodium falciparum (isolate 3D7) |
|---|
| Description: | ChEMBL_774240 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MEKYHGLEKIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTIREISILKELKHS
NIVKLYDVIHTKKRLVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRR
VLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYST
TIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTV
YEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKENN
|
|
|
|---|
| BDBM5655 |
|---|
| n/a |
|---|
| Name | BDBM5655 |
|---|
| Synonyms: | 2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydroxy-1-methylpiperidin-4-yl]-4H-chromen-4-one | CHEMBL428690 | Flavopiridol | US10294218, Example Flavopiridol | US9617225, Flavopiridol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20ClNO5 |
|---|
| Mol. Mass. | 401.84 |
|---|
| SMILES | CN1CC[C@@H]([C@H](O)C1)c1c(O)cc(O)c2c1oc(cc2=O)-c1ccccc1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
