Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity testis-specific protein kinase 1
LigandBDBM50309910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774536
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity testis-specific protein kinase 1
Name:Dual specificity testis-specific protein kinase 1
Synonyms:TESK1
Type:PROTEIN
Mol. Mass.:67696.22
Organism:Homo sapiens (Human)
Description:ChEMBL_587103
Residue:626
Sequence:
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50309910
n/a
NameBDBM50309910
Synonyms:CHEMBL608154 | ML-120B | N-(6-chloro-7-methoxy-9H-pyrido[3,4-b]indol-8-yl)-2-methylnicotinamide
TypeSmall organic molecule
Emp. Form.C19H15ClN4O2
Mol. Mass.366.801
SMILESCOc1c(Cl)cc2c3ccncc3[nH]c2c1NC(=O)c1cccnc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: