Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 15
LigandBDBM24654
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774198
Kd 62±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 15
Name:Cyclin-dependent kinase 15
Synonyms:ALS2CR7 | Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein | CDK15 | Cell division protein kinase 15 | PFTK2 | Serine/threonine-protein kinase ALS2CR7 | Serine/threonine-protein kinase PFTAIRE-2
Type:PROTEIN
Mol. Mass.:49029.02
Organism:Homo sapiens (Human)
Description:ChEMBL_655517
Residue:435
Sequence:
MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGL
QAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEA
EDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA
SYQKGHHPAQFSKCW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24654
n/a
NameBDBM24654
Synonyms:4-N-(2,6-dichlorobenzene)-3-N-(piperidin-4-yl)-1H-pyrazole-3,4-diamido | AT7519 | JMC514986 Compound 33 | pyrazole diamide, 33
TypeSmall organic molecule
Emp. Form.C16H17Cl2N5O2
Mol. Mass.382.244
SMILESClc1cccc(Cl)c1C(=O)Nc1cn[nH]c1C(=O)NC1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: