Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral plasma membrane protein CASK
LigandBDBM50322823
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774229
Kd>10000±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral plasma membrane protein CASK
Name:Peripheral plasma membrane protein CASK
Synonyms:Calcium/calmodulin-dependent serine protein kinase | Protein lin-2 homolog | hCASK
Type:PROTEIN
Mol. Mass.:105119.01
Organism:Homo sapiens (Human)
Description:ChEMBL_774229
Residue:926
Sequence:
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM
DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN
GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK
LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVF
DQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKK
DEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEID
ETIRHLEEAVELVCTAPQWVPVSWVY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322823
n/a
NameBDBM50322823
Synonyms:(S)-N-(4-(3-chloro-4-fluorophenylamino)-7-(tetrahydrofuran-3-yloxy)quinazolin-6-yl)-4-(dimethylamino)but-2-enamide | AFATINIB | CHEMBL1173655 | US10085983, Compound BIBW2992 | US10196365, Afatinib | US9388170, Afatinib
TypeSmall organic molecule
Emp. Form.C24H25ClFN5O3
Mol. Mass.485.938
SMILESCN(C)C\C=C\C(=O)Nc1cc2c(Nc3ccc(F)c(Cl)c3)ncnc2cc1O[C@H]1CCOC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: