Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase I delta
LigandBDBM4552
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774598
Kd 550±n/a nM
Citation Davis MIHunt JPHerrgard SCiceri PWodicka LMPallares GHocker MTreiber DKZarrinkar PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol 29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase I delta
Name:CaM kinase I delta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42916.83
Organism:Homo sapiens (Human)
Description:ChEMBL_586559
Residue:385
Sequence:
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4552
n/a
NameBDBM4552
Synonyms:4-[(2,4-Dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methyl-1-piperazinyl)propoxy]-3-quinolinecarbonitrile | 4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-1-yl)propoxy]quinoline-3-carbonitrile | BOSUTINIB | CHEMBL288441 | SKI-606
TypeSmall organic molecule
Emp. Form.C26H29Cl2N5O3
Mol. Mass.530.446
SMILESCOc1cc(Nc2c(cnc3cc(OCCCN4CCN(C)CC4)c(OC)cc23)C#N)c(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: