Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 2 homolog |
---|
Ligand | BDBM5931 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_774240 (CHEMBL1908457) |
---|
Kd | >10000±n/a nM |
---|
Citation | Davis, MI; Hunt, JP; Herrgard, S; Ciceri, P; Wodicka, LM; Pallares, G; Hocker, M; Treiber, DK; Zarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 2 homolog |
---|
Name: | Cyclin-dependent kinase 2 homolog |
Synonyms: | CDK2H_PLAF7 | CRK2 | Cell division control protein 2 homolog | PK5 |
Type: | PROTEIN |
Mol. Mass.: | 33000.81 |
Organism: | Plasmodium falciparum (isolate 3D7) |
Description: | ChEMBL_774240 |
Residue: | 288 |
Sequence: | MEKYHGLEKIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTIREISILKELKHS
NIVKLYDVIHTKKRLVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRR
VLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKYTHEVVTLWYRAPDVLMGSKKYST
TIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTV
YEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKENN
|
|
|
BDBM5931 |
---|
n/a |
---|
Name | BDBM5931 |
Synonyms: | BMS-387072 | CHEMBL296468 | N-(5-{[(5-tert-butyl-1,3-oxazol-2-yl)methyl]sulfanyl}-1,3-thiazol-2-yl)piperidine-4-carboxamide | N-[5-[[[5-(1,1-Dimethylethyl)-2-oxazolyl]methyl]thio]-2-thiazolyl]-4-piperidinecarboxamide | cid_3025986 |
Type | Small organic molecule |
Emp. Form. | C17H24N4O2S2 |
Mol. Mass. | 380.528 |
SMILES | CC(C)(C)c1cnc(CSc2cnc(NC(=O)C3CCNCC3)s2)o1 |
Structure |
|