Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50355773 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_776493 (CHEMBL1913590) |
---|
IC50 | 3464±n/a nM |
---|
Citation | Cappelli, A; Bini, G; Valenti, S; Giuliani, G; Paolino, M; Anzini, M; Vomero, S; Giorgi, G; Giordani, A; Stasi, LP; Makovec, F; Ghelardini, C; Di Cesare Mannelli, L; Concas, A; Porcu, P; Biggio, G Synthesis and structure-activity relationship studies in translocator protein ligands based on a pyrazolo[3,4-b]quinoline scaffold. J Med Chem54:7165-75 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50355773 |
---|
n/a |
---|
Name | BDBM50355773 |
Synonyms: | CHEMBL1911612 |
Type | Small organic molecule |
Emp. Form. | C33H28N4O2 |
Mol. Mass. | 512.601 |
SMILES | Cc1c2c(nc3ccccc13)n(CC(=O)N(Cc1ccccc1)Cc1ccccc1)n(-c1ccccc1)c2=O |
Structure |
|