| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50357781 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_786290 (CHEMBL1920395) |
|---|
| EC50 | 1.3±n/a nM |
|---|
| Citation |  Buzard, D; Han, S; Thoresen, L; Moody, J; Lopez, L; Kawasaki, A; Schrader, T; Sage, C; Gao, Y; Edwards, J; Barden, J; Thatte, J; Fu, L; Solomon, M; Liu, L; Al-Shamma, H; Gatlin, J; Le, M; Xing, C; Espinola, S; Jones, RM Discovery and characterization of potent and selective 4-oxo-4-(5-(5-phenyl-1,2,4-oxadiazol-3-yl)indolin-1-yl)butanoic acids as S1P¿? agonists. Bioorg Med Chem Lett21:6013-8 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CD_antigen=CD363 | Edg1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor 1 | S1P receptor Edg-1 | S1P1 | S1PR1_RAT | S1pr1 | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42770.88 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1463793 |
|---|
| Residue: | 383 |
|---|
| Sequence: | MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI
ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL
REGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPI
MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK
NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL
AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS
HPQKDDGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50357781 |
|---|
| n/a |
|---|
| Name | BDBM50357781 |
|---|
| Synonyms: | CHEMBL1916559 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H15F6N3O4 |
|---|
| Mol. Mass. | 499.3626 |
|---|
| SMILES | OC(=O)CCC(=O)N1CCc2cc(ccc12)-c1noc(n1)-c1cc(cc(c1)C(F)(F)F)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
