Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50219916 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_788809 (CHEMBL1924794) |
---|
Ki | 28±n/a nM |
---|
Citation | Mitch, CH; Quimby, SJ; Diaz, N; Pedregal, C; de la Torre, MG; Jimenez, A; Shi, Q; Canada, EJ; Kahl, SD; Statnick, MA; McKinzie, DL; Benesh, DR; Rash, KS; Barth, VN Discovery of aminobenzyloxyarylamides as¿ opioid receptor selective antagonists: application to preclinical development of a¿ opioid receptor antagonist receptor occupancy tracer. J Med Chem54:8000-12 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50219916 |
---|
n/a |
---|
Name | BDBM50219916 |
Synonyms: | 6-(4-((benzylamino)methyl)phenoxy)nicotinamide | CHEMBL238316 |
Type | Small organic molecule |
Emp. Form. | C20H19N3O2 |
Mol. Mass. | 333.3838 |
SMILES | NC(=O)c1ccc(Oc2ccc(CNCc3ccccc3)cc2)nc1 |
Structure |
|