Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSyk protein
LigandBDBM50360606
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795546
IC50 1810±n/a nM
Citation Powell NAKohrt JTFilipski KJKaufman MSheehan DEdmunds JEDelaney AWang YBourbonais FLee DYSchwende FSun FMcConnell PCatana CChen HOhren JPerrin LA Novel and selective spiroindoline-based inhibitors of Sky kinase. Bioorg Med Chem Lett 22:190-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Syk protein
Name:Syk protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:71353.61
Organism:Mus musculus
Description:ChEMBL_795546
Residue:629
Sequence:
MAGSAVDSANHLTYLFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKA
HHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQT
VLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGAQMGHPGSPNAHPVTWSPGGIISRIKSYSFPKPGHKKP
APPQGSRPESTVSFNPYEPTGGPWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLD
RSLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLE
ESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINY
YKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMN
LCWTYDVENRPGFTAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360606
n/a
NameBDBM50360606
Synonyms:CHEMBL1933539
TypeSmall organic molecule
Emp. Form.C23H23FN4O
Mol. Mass.390.4533
SMILESFc1ccc2[nH]c(cc2c1)C(=O)N1C[C@]2(CCN(C2)C2CNC2)c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: