Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase receptor UFO
LigandBDBM50360605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795657
IC50 19400±n/a nM
Citation Powell NAKohrt JTFilipski KJKaufman MSheehan DEdmunds JEDelaney AWang YBourbonais FLee DYSchwende FSun FMcConnell PCatana CChen HOhren JPerrin LA Novel and selective spiroindoline-based inhibitors of Sky kinase. Bioorg Med Chem Lett 22:190-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase receptor UFO
Name:Tyrosine-protein kinase receptor UFO
Synonyms:2.7.10.1 | AXL | AXL oncogene | Tyrosine-protein kinase receptor UFO (AXL) | UFO
Type:Enzyme
Mol. Mass.:98316.99
Organism:Homo sapiens (Human)
Description:P30530
Residue:894
Sequence:
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR
YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGK
TLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGM
EYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIES
LADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYA
LMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360605
n/a
NameBDBM50360605
Synonyms:CHEMBL1933538
TypeSmall organic molecule
Emp. Form.C25H27FN4O
Mol. Mass.418.5065
SMILESFc1ccc2[nH]c(cc2c1)C(=O)N1C[C@]2(CCN(C2)C2CCCNC2)c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: