Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-2
LigandBDBM50360611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795650
IC50>30000±n/a nM
Citation Powell NAKohrt JTFilipski KJKaufman MSheehan DEdmunds JEDelaney AWang YBourbonais FLee DYSchwende FSun FMcConnell PCatana CChen HOhren JPerrin LA Novel and selective spiroindoline-based inhibitors of Sky kinase. Bioorg Med Chem Lett 22:190-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-2
Name:Serine/threonine-protein kinase pim-2
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (Human)
Description:n/a
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360611
n/a
NameBDBM50360611
Synonyms:CHEMBL1933550
TypeSmall organic molecule
Emp. Form.C24H25FN4O
Mol. Mass.404.4799
SMILESFc1ccc2cc([nH]c2c1)C(=O)N1C[C@]2(CCN(C2)C2CCNC2)c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: