Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 Receptor
LigandBDBM22566
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795784
Ki 6±n/a nM
Citation Smits RALim HDvan der Meer TKuhne SBessembinder KZuiderveld OPWijtmans Mde Esch IJLeurs R Ligand based design of novel histamine H4 receptor antagonists; fragment optimization and analysis of binding kinetics. Bioorg Med Chem Lett 22:461-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 Receptor
Name:Histamine H4 Receptor
Synonyms:HH4R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44045.07
Organism:Rattus norvegicus (rat)
Description:Cell pellets from SK-N-MC cells transfected with rat H4 receptor were used in binding assay.
Residue:391
Sequence:
MSESNGTDVLPLTAQVPLAFLMSLLAFAITIGNAVVILAFVADRNLRHRSNYFFLNLAIS
DFFVGVISIPLYIPHTLFNWNFGSGICMFWLITDYLLCTASVYSIVLISYDRYQSVSNAV
RYRAQHTGILKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTEECEPGFVTEWYILAIT
AFLEFLLPVSLVVYFSVQIYWSLWKRGSLSRCPSHAGFIATSSRGTGHSRRTGLACRTSL
PGLKEPAASLHSESPRGKSSLLVSLRTHMSGSIIAFKVGSFCRSESPVLHQREHVELLRG
RKLARSLAVLLSAFAICWAPYCLFTIVLSTYRRGERPKSIWYSIAFWLQWFNSLINPFLY
PLCHRRFQKAFWKILCVTKQPAPSQTQSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22566
n/a
NameBDBM22566
Synonyms:5-chloro-2-[(4-methylpiperazin-1-yl)carbonyl]-1H-indole | CHEMBL129198 | JNJ 7777120
TypeSmall organic molecule
Emp. Form.C14H16ClN3O
Mol. Mass.277.749
SMILESCN1CCN(CC1)C(=O)c1cc2cc(Cl)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: