Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal Pro-X carboxypeptidase
LigandBDBM50364689
Substrate/Competitorn/a
Meas. Tech.ChEMBL_802882
IC50 0.11±n/a nM
Citation Shen HCDing FXJiang JVerras AChabin RMXu STong XChen QXie DLassman MEBhatt URGarcia-Calvo MMGeissler WShen ZMurphy BAGorski JNWiltsie JSinhaRoy RHale JJPinto SShen DM Discovery of benzodihydroisofurans as novel, potent, bioavailable and brain-penetrant prolylcarboxypeptidase inhibitors. Bioorg Med Chem Lett 22:1550-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal Pro-X carboxypeptidase
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:PROTEIN
Mol. Mass.:55028.96
Organism:Mus musculus
Description:ChEMBL_1335505
Residue:491
Sequence:
MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGF
ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEH
RYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGG
MLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWN
VIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLP
AWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQ
ACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNI
IFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMK
KWILDFYSNIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364689
n/a
NameBDBM50364689
Synonyms:CHEMBL1951478
TypeSmall organic molecule
Emp. Form.C23H19ClF3N3O4S
Mol. Mass.525.928
SMILES[O-][n+]1ccc(Cl)cc1C1OC2(CCN(CC2)S(=O)(=O)c2ccc(cn2)C(F)(F)F)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: