| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM50001747 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_155147 |
|---|
| IC50 | 150±n/a nM |
|---|
| Citation |  Sahoo, SP; Graham, DW; Acton, J; Biftu, T; Bugianesi, RL; Girotra, NN; Kuo, C; Ponpipom, MM; Doebber, TW; Wu, MS; Hwang, S; Lam, M; MacIntyre, D; Bach, TJ; Luell, S; Meurer, R; Davies, P; Alberts, AW; Chabala, JC Synthesis and biological activity of MK 287 (L-680,573): a potent, specific and orally active paf receptor antagonist Bioorg Med Chem Lett1:327-332 (1991) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF-R | PTAFR | PTAFR_CAVPO | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39005.63 |
|---|
| Organism: | Cavia porcellus |
|---|
| Description: | n/a |
|---|
| Residue: | 342 |
|---|
| Sequence: | MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
|
|
|
|---|
| BDBM50001747 |
|---|
| n/a |
|---|
| Name | BDBM50001747 |
|---|
| Synonyms: | (+)-Kadsurenone | (Kadsurenone)5-Allyl-2-(3,4-dimethoxy-phenyl)-3a-methoxy-3-methyl-3,3a-dihydro-2H-benzofuran-6-one | 5-Allyl-2-(3,4-dimethoxy-phenyl)-3a-methoxy-3-methyl-3,3a-dihydro-2H-benzofuran-6-one | CHEMBL296958 | KADSURENONE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24O5 |
|---|
| Mol. Mass. | 356.4123 |
|---|
| SMILES | COc1ccc(cc1OC)[C@H]1OC2=CC(=O)C(CC=C)=C[C@]2(OC)[C@@H]1C |c:20,t:13| |
|---|
| Structure | 
|
|---|
Search and Browse
