| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM50282047 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_155135 |
|---|
| IC50 | 120±n/a nM |
|---|
| Citation |  Wood, L; Whittaker, M; Timmis, DJ; Thompson, TM; Saroglou, L; Miller, A; Davidson, AH; Christodoulou, MS; Cackett, KS; Bowles, SA; Bebbington, DS Cyclic ether acetal platelet activating factor (PAF) receptor antagonists II: imidazo[4,5-c]pyridyl derivatives Bioorg Med Chem Lett3:1499-1504 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39219.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
|---|
| BDBM50282047 |
|---|
| n/a |
|---|
| Name | BDBM50282047 |
|---|
| Synonyms: | 1-[3-(5-Heptyl-tetrahydro-furan-2-yloxy)-propyl]-2-methyl-1H-imidazo[4,5-c]pyridine | CHEMBL34612 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H33N3O2 |
|---|
| Mol. Mass. | 359.5056 |
|---|
| SMILES | CCCCCCCC1CCC(OCCCn2c(C)nc3cnccc23)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
