Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAVPR1A
LigandBDBM50108501
Substrate/Competitorn/a
Meas. Tech.ChEBML_214566
Ki 0.102000±n/a nM
Citation Kakefuda ATsukada JKusayama TTahara ATsukamoto S N-Methylbenzanilide derivatives as a novel class of selective V(1A) receptor antagonists. Bioorg Med Chem Lett 12:229-32 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
AVPR1A
Name:Vasopressin receptor
Synonyms:VASOPRESSIN V1A | Vasopressin V1 receptor | Vasopressin V1a receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:47674.81
Organism:RAT
Description:VASOPRESSIN V1A AVPR1A RAT::P30560
Residue:424
Sequence:
MSFPRGSQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAKLEIAVLAV
IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP
DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFI
LSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGF
ICYHIWRNIRGKTASSRHSKGDKGSGEAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTF
VIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH
LLQDCVQSFPCCHSMAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGMWKDSPKSSKSIRFI
PVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108501
n/a
NameBDBM50108501
Synonyms:2-Methyl-furan-3-carboxylic acid (4-{5-[2-(4-dimethylamino-piperidin-1-yl)-2-oxo-ethylidene]-4,4-difluoro-2,3,4,5-tetrahydro-benzo[b]azepine-1-carbonyl}-phenyl)-amide | CHEMBL310921
TypeSmall organic molecule
Emp. Form.C32H34F2N4O4
Mol. Mass.576.6336
SMILESCN(C)C1CCN(CC1)C(=O)\C=C1/c2ccccc2N(CCC1(F)F)C(=O)c1ccc(NC(=O)c2ccoc2C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: