| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenylate kinase 2, mitochondrial |
|---|
| Ligand | BDBM50367044 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_32052 (CHEMBL873039) |
|---|
| Ki | 2800±n/a nM |
|---|
| Citation |  Kappler, F; Hai, TT; Abo, M; Hampton, A Species- or isozyme-specific enzyme inhibitors. 8. Synthesis of disubstituted two-substrate condensation products as inhibitors of rat adenylate kinases. J Med Chem25:1179-84 (1983) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenylate kinase 2, mitochondrial |
|---|
| Name: | Adenylate kinase 2, mitochondrial |
|---|
| Synonyms: | 2.7.4.3 | AK 2 | ATP-AMP transphosphorylase 2 | ATP:AMP phosphotransferase | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | Adenylate monophosphate kinase | Ak2 | KAD2_RAT |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 26380.21 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | n/a |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAPNALAPEPEHPEGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFV
|
|
|
|---|
| BDBM50367044 |
|---|
| n/a |
|---|
| Name | BDBM50367044 |
|---|
| Synonyms: | CHEMBL605639 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H35N10O22P5S |
|---|
| Mol. Mass. | 990.512 |
|---|
| SMILES | CCSc1nc2c(N)ncnc2n1C1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)O[C@H](C)[C@H]2OC([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
