Reaction Details |
| Report a problem with these data |
Target | Adenylate kinase 2, mitochondrial |
---|
Ligand | BDBM50027447 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_32050 (CHEMBL644150) |
---|
Ki | 3600000±n/a nM |
---|
Citation | Hai, TT; Picker, D; Abo, M; Hampton, A Species- or isozyme-specific enzyme inhibitors. 7. Selective effects in inhibitions of rat adenylate kinase isozymes by adenosine 5'-phosphate derivatives. J Med Chem25:806-12 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenylate kinase 2, mitochondrial |
---|
Name: | Adenylate kinase 2, mitochondrial |
Synonyms: | 2.7.4.3 | AK 2 | ATP-AMP transphosphorylase 2 | ATP:AMP phosphotransferase | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | Adenylate monophosphate kinase | Ak2 | KAD2_RAT |
Type: | n/a |
Mol. Mass.: | 26380.21 |
Organism: | Rattus norvegicus |
Description: | n/a |
Residue: | 239 |
Sequence: | MAPNALAPEPEHPEGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFV
|
|
|
BDBM50027447 |
---|
n/a |
---|
Name | BDBM50027447 |
Synonyms: | CHEMBL1229561 | Phosphoric acid mono-[5-(6-amino-purin-9-yl)-3-hydroxy-4-methoxy-tetrahydro-furan-2-ylmethyl] ester |
Type | Small organic molecule |
Emp. Form. | C11H16N5O7P |
Mol. Mass. | 361.2478 |
SMILES | CO[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1n1cnc2c(N)ncnc12 |r| |
Structure |
|